TARS Antibody

Images

 
Western Blot: TARS Antibody [NBP1-89427] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG
Immunocytochemistry/ Immunofluorescence: TARS Antibody [NBP1-89427] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: TARS Antibody [NBP1-89427] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Simple Western: TARS Antibody [NBP1-89427] - Simple Western lane view shows a specific band for TARS in 0.2 mg/ml of U-251 MG (left) and H. Pancreas (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: TARS Antibody [NBP1-89427] - Electropherogram image of the corresponding Simple Western lane view. TARS antibody was used at 1:25 dilution on U-251 MG and H. Pancreas lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNIL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
TARS Protein (NBP1-89427PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TARS Antibody

  • cytoplasmic
  • EC 6.1.1.3
  • MGC9344
  • Threonine--tRNA ligase
  • threonyl-tRNA synthetase
  • threonyl-tRNA synthetase, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-01425
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-88067
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P

Publications for TARS Antibody (NBP1-89427) (0)

There are no publications for TARS Antibody (NBP1-89427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TARS Antibody (NBP1-89427) (0)

There are no reviews for TARS Antibody (NBP1-89427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TARS Antibody (NBP1-89427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TARS Products

Bioinformatics Tool for TARS Antibody (NBP1-89427)

Discover related pathways, diseases and genes to TARS Antibody (NBP1-89427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TARS Antibody (NBP1-89427)

Discover more about diseases related to TARS Antibody (NBP1-89427).
 

Pathways for TARS Antibody (NBP1-89427)

View related products by pathway.

PTMs for TARS Antibody (NBP1-89427)

Learn more about PTMs related to TARS Antibody (NBP1-89427).

Blogs on TARS

There are no specific blogs for TARS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TARS