TARBP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TARBP1 Antibody [NBP1-86902] - Staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: TARBP1 Antibody [NBP1-86902] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TARBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TARBP1 Antibody - BSA Free (NBP1-86902) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TARBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TARBP1 Protein (NBP1-86902PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TARBP1 Antibody - BSA Free

• EC 2.1.1.-
• FLJ30482
• TAR (HIV-1) RNA binding protein 1
• TAR RNA loop binding protein
• TAR RNA-binding protein 1
• TAR RNA-binding protein of 185 kDa
• tardbp1
• TRM3probable methyltransferase TARBP1
• TRP-185TAR (HIV) RNA binding protein 1
• TRP185TAR (HIV) RNA-binding protein 1

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. This element forms a stable stem-loop structure and can be bound by either the protein encoded by this gene or by RNA polymerase II. This protein may act to disengage RNA polymerase II from TAR during transcriptional elongation. Alternatively spliced transcripts of this gene may exist, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TARBP1