TAP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAP2 Antibody [NBP1-89312] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and endoplasmic reticulum.
Immunohistochemistry-Paraffin: TAP2 Antibody [NBP1-89312] - Staining of human tonsil shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAP2 Protein (NBP1-89312PEP)
Publications
Read Publications using
NBP1-89312 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAP2 Antibody

  • ABCB3ABC18
  • antigen peptide transporter 2
  • APT2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 3
  • D6S217E
  • MHC 2
  • Peptide transporter involved in antigen processing 2
  • Peptide transporter PSF2
  • Peptide transporter TAP2
  • PSF2PSF-2
  • Really interesting new gene 11 protein
  • RING11ATP-binding cassette sub-family B member 3
  • transporter 2, ABC (ATP binding cassette)
  • transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
  • Y1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NLS1071
Species: Hu
Applications: IHC-P
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P

Publications for TAP2 Antibody (NBP1-89312)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TAP2 Antibody (NBP1-89312) (0)

There are no reviews for TAP2 Antibody (NBP1-89312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAP2 Antibody (NBP1-89312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAP2 Products

Bioinformatics Tool for TAP2 Antibody (NBP1-89312)

Discover related pathways, diseases and genes to TAP2 Antibody (NBP1-89312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAP2 Antibody (NBP1-89312)

Discover more about diseases related to TAP2 Antibody (NBP1-89312).
 

Pathways for TAP2 Antibody (NBP1-89312)

View related products by pathway.

PTMs for TAP2 Antibody (NBP1-89312)

Learn more about PTMs related to TAP2 Antibody (NBP1-89312).

Blogs on TAP2

There are no specific blogs for TAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAP2