TAP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TAP1 Antibody [NBP2-55934] - Staining of human cell line HaCaT shows localization to endoplasmic reticulum.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAP1 Antibody - BSA Free (NBP2-55934) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TAP1 Recombinant Protein Antigen (NBP2-55934PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TAP1 Antibody - BSA Free

• ABC Transporter, MHC 1
• ABC17
• ABCB2
• ABCB2FLJ41500
• antigen peptide transporter 1
• APT1
• ATP-binding cassette sub-family B member 2
• ATP-binding cassette, sub-family B (MDR/TAP), member 2
• D6S114E
• Ham1
• Peptide supply factor 1
• Peptide transporter involved in antigen processing 1
• Peptide transporter PSF1
• Peptide Transporter TAP1
• PSF1
• PSF-1
• PSF1ABC17
• Really interesting new gene 4 protein
• RING4
• RING4FLJ26666
• TAP1
• TAP1*0102N
• TAP1N
• transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
• transporter associated with antigen processing
• transporter, ATP-binding cassette, major histocompatibility complex, 1
• Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAP1