TANC1 Antibody

Images

 
Immunohistochemistry-Paraffin: TANC1 Antibody [NBP1-82896] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TANC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQEGLQSKGRPVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQNPPPSPMPGRIAATP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TANC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TANC1 Protein (NBP1-82896PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TANC1 Antibody

  • FLJ13360
  • FLJ41166
  • KIAA1728
  • protein TANC1
  • rolling pebbles homolog B
  • ROLSB
  • TANC
  • tetratricopeptide repeat, ankyrin repeat and coiled-coil containing 1
  • tetratricopeptide repeat, ankyrin repeat and coiled-coil domain-containing protein 1
  • TPR domain, ankyrin-repeat and coiled-coil-containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS7401
Species: Hu, Mu, Rt, Bt, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
25910002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-82896
Species: Hu
Applications: IHC, IHC-P

Publications for TANC1 Antibody (NBP1-82896) (0)

There are no publications for TANC1 Antibody (NBP1-82896).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TANC1 Antibody (NBP1-82896) (0)

There are no reviews for TANC1 Antibody (NBP1-82896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TANC1 Antibody (NBP1-82896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TANC1 Products

TANC1 NBP1-82896

Bioinformatics Tool for TANC1 Antibody (NBP1-82896)

Discover related pathways, diseases and genes to TANC1 Antibody (NBP1-82896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TANC1 Antibody (NBP1-82896)

Discover more about diseases related to TANC1 Antibody (NBP1-82896).
 

Pathways for TANC1 Antibody (NBP1-82896)

View related products by pathway.

PTMs for TANC1 Antibody (NBP1-82896)

Learn more about PTMs related to TANC1 Antibody (NBP1-82896).

Blogs on TANC1

There are no specific blogs for TANC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TANC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TANC1