TACC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TACC3 Antibody [NBP1-84810] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: TACC3 Antibody [NBP1-84810] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TACC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TACC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TACC3 Protein (NBP1-84810PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TACC3 Antibody

  • ERIC-1
  • ERIC1ERIC-1
  • MGC117382
  • MGC133242
  • TACC3
  • transforming acidic coiled-coil-containing protein 3
  • transforming, acidic coiled-coil containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46058
Species: Hu
Applications: WB, IHC
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46085
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TACC3 Antibody (NBP1-84810) (0)

There are no publications for TACC3 Antibody (NBP1-84810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TACC3 Antibody (NBP1-84810) (0)

There are no reviews for TACC3 Antibody (NBP1-84810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TACC3 Antibody (NBP1-84810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TACC3 Products

Bioinformatics Tool for TACC3 Antibody (NBP1-84810)

Discover related pathways, diseases and genes to TACC3 Antibody (NBP1-84810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TACC3 Antibody (NBP1-84810)

Discover more about diseases related to TACC3 Antibody (NBP1-84810).
 

Pathways for TACC3 Antibody (NBP1-84810)

View related products by pathway.

PTMs for TACC3 Antibody (NBP1-84810)

Learn more about PTMs related to TACC3 Antibody (NBP1-84810).
 

Research Areas for TACC3 Antibody (NBP1-84810)

Find related products by research area.

Blogs on TACC3

There are no specific blogs for TACC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TACC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TACC3
Entrez