t-Plasminogen Activator/tPA Antibody

Images

 
Western Blot: t-Plasminogen Activator/tPA Antibody [NBP1-87491] - Analysis in control (vector only transfected HEK293T lysate) and pLAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: t-Plasminogen Activator/tPA Antibody [NBP1-87491] - Staining of human duodenum shows strong positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

t-Plasminogen Activator/tPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
t-Plasminogen Activator/tPA Protein (NBP1-87491PEP)
Publications
Read Publication using NBP1-87491.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for t-Plasminogen Activator/tPA Antibody

  • Alteplase
  • DKFZp686I03148
  • EC 3.4.21
  • EC 3.4.21.68
  • plasminogen activator, tissue type
  • plasminogen activator, tissue
  • PLAT
  • Reteplase
  • tissue plasminogen activator (t-PA)
  • tissue-type plasminogen activator
  • TPA
  • T-PA
  • tPlasminogen Activator
  • t-Plasminogen Activator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP2-07799
Species: Hu
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for t-Plasminogen Activator/tPA Antibody (NBP1-87491)(1)

Reviews for t-Plasminogen Activator/tPA Antibody (NBP1-87491) (0)

There are no reviews for t-Plasminogen Activator/tPA Antibody (NBP1-87491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for t-Plasminogen Activator/tPA Antibody (NBP1-87491). (Showing 1 - 1 of 1 FAQ).

  1. For the following antibodies our customer would like to find the percentage of purity: Tissue Plasminogen Activator Antibody (NBP1-87491), and Tissue Plasminogen Activator Antibody (NBP1-57814).
    • Both of these antibodies are affinity purified, so the purity is expected to be greater than 95%.

Secondary Antibodies

 

Isotype Controls

Additional t-Plasminogen Activator/tPA Products

Bioinformatics Tool for t-Plasminogen Activator/tPA Antibody (NBP1-87491)

Discover related pathways, diseases and genes to t-Plasminogen Activator/tPA Antibody (NBP1-87491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for t-Plasminogen Activator/tPA Antibody (NBP1-87491)

Discover more about diseases related to t-Plasminogen Activator/tPA Antibody (NBP1-87491).
 

Pathways for t-Plasminogen Activator/tPA Antibody (NBP1-87491)

View related products by pathway.

PTMs for t-Plasminogen Activator/tPA Antibody (NBP1-87491)

Learn more about PTMs related to t-Plasminogen Activator/tPA Antibody (NBP1-87491).

Blogs on t-Plasminogen Activator/tPA

There are no specific blogs for t-Plasminogen Activator/tPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our t-Plasminogen Activator/tPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAT
Entrez