We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human T-bet/TBX21 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human T-bet/TBX21 Protein [H00030009-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related T-bet/TBX21 Peptides and Proteins

Order Details


    • Catalog Number
      H00030009-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human T-bet/TBX21 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_037483) for Human T-bet/TBX21

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBX21
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
40.59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human T-bet/TBX21 GST (N-Term) Protein

  • Tbet
  • T-bet
  • TBETT-PET
  • TBLYM
  • TBLYMT-cell-specific T-box transcription factor T-bet
  • T-box 21
  • T-box expressed in T cells
  • T-box protein 21
  • T-box transcription factor TBX21
  • TBX21
  • T-PET
  • Transcription factor TBLYM

Background

Tbx21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2605
Applications: ICC, IHC, Simple Western, WB
AF2605
Applications: ICC, IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY417
Applications: ELISA
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
DY421
Applications: ELISA
M5000
Applications: ELISA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
DY413
Applications: ELISA
H00006775-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF6166
Applications: CyTOF-ready, ICC, ICFlow, WB
AF2894
Applications: CyTOF-ready, ICFlow, Simple Western, WB
MAB2274
Applications: CyTOF-ready, ICFlow, WB
7268-CT
Applications: BA
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
H00030009-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for T-bet/TBX21 Recombinant Protein (H00030009-Q01) (0)

There are no publications for T-bet/TBX21 Recombinant Protein (H00030009-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for T-bet/TBX21 Recombinant Protein (H00030009-Q01) (0)

There are no reviews for T-bet/TBX21 Recombinant Protein (H00030009-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for T-bet/TBX21 Recombinant Protein (H00030009-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Do you make a Tbx21 ab for FACS for porcine?
    • We have not tested our Tbx21 antibodies for porcine, however you might like to test NBP1-43298 as part of our Innovators Reward Program. This is gained from testing a product on a species or application that we have not yet tested. I have carried out a blast to check the % homology between the pig protein and human protein, this is 94% and our lab recommends use if the % homology is 85% or above.

Additional T-bet/TBX21 Products

Research Areas for T-bet/TBX21 Recombinant Protein (H00030009-Q01)

Find related products by research area.

Blogs on T-bet/TBX21

There are no specific blogs for T-bet/TBX21, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human T-bet/TBX21 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX21