SYTL4 Antibody

Images

 
Western Blot: SYTL4 Antibody [NBP1-86174] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: SYTL4 Antibody [NBP1-86174] - Staining of human cell line A-431 shows localization to nucleoplasm, cytosol & microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SYTL4 Antibody [NBP1-86174] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYTL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYTL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SYTL4 Protein (NBP1-86174PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYTL4 Antibody

  • DKFZp451P0116
  • exophilin-2
  • FLJ40960
  • Granuphilin
  • granuphilin-a
  • SLP4
  • synaptotagmin-like 4
  • synaptotagmin-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
H00005874-B01P
Species: Hu, Rb
Applications: WB, ICC/IF
NBL1-16657
Species: Hu
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-83942
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-69184
Species: Mu, Rt
Applications: WB
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86053
Species: Hu
Applications: IHC, IHC-P

Publications for SYTL4 Antibody (NBP1-86174) (0)

There are no publications for SYTL4 Antibody (NBP1-86174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYTL4 Antibody (NBP1-86174) (0)

There are no reviews for SYTL4 Antibody (NBP1-86174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SYTL4 Antibody (NBP1-86174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYTL4 Products

Bioinformatics Tool for SYTL4 Antibody (NBP1-86174)

Discover related pathways, diseases and genes to SYTL4 Antibody (NBP1-86174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYTL4 Antibody (NBP1-86174)

Discover more about diseases related to SYTL4 Antibody (NBP1-86174).
 

Pathways for SYTL4 Antibody (NBP1-86174)

View related products by pathway.

Blogs on SYTL4

There are no specific blogs for SYTL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYTL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYTL4