RAB27B Antibody - BSA Free

Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining in human prostate and tonsil tissues . Corresponding RAB27B RNA-seq data are presented for the same tissues.

Staining of human prostate shows strong apical membrane and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human tonsil shows mainly very weak positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.

Analysis in human cell line U-87 MG.

Analysis in control (vector only transfected HEK293T lysate) and RAB27B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAB27B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAB27B Antibody - BSA Free (NBP1-89538) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB27B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RAB27B Protein (NBP1-89538PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAB27B Antibody - BSA Free

• C25KG
• RAB27B, member RAS oncogene family
• ras-related protein Rab-27B

Background

RAB27B may be involved in targeting uroplakins to urothelial apical membranes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB27B