RAB27B Antibody


Western Blot: RAB27B Antibody [NBP1-89538] - Staining of human prostate shows strong apical membrane and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human tonsil shows mainly very weak positivity in lymphoid cells as expected.
Western Blot: RAB27B Antibody [NBP1-89538] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human urinary bladder shows strong apical membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining in human prostate and tonsil tissues. Corresponding RAB27B RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RAB27B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Specificity of human RAB27B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB27B Protein (NBP1-89538PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RAB27B Antibody

  • C25KG
  • RAB27B, member RAS oncogene family
  • ras-related protein Rab-27B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RAB27B Antibody (NBP1-89538) (0)

There are no publications for RAB27B Antibody (NBP1-89538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB27B Antibody (NBP1-89538) (0)

There are no reviews for RAB27B Antibody (NBP1-89538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB27B Antibody (NBP1-89538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAB27B Products

Bioinformatics Tool for RAB27B Antibody (NBP1-89538)

Discover related pathways, diseases and genes to RAB27B Antibody (NBP1-89538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB27B Antibody (NBP1-89538)

Discover more about diseases related to RAB27B Antibody (NBP1-89538).

Pathways for RAB27B Antibody (NBP1-89538)

View related products by pathway.

PTMs for RAB27B Antibody (NBP1-89538)

Learn more about PTMs related to RAB27B Antibody (NBP1-89538).

Blogs on RAB27B

There are no specific blogs for RAB27B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAB27B Antibody and receive a gift card or discount.


Gene Symbol RAB27B