SYT11 Recombinant Protein Antigen

Images

 
There are currently no images for SYT11 Protein (NBP2-39015PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SYT11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYT11.

Source: E.coli

Amino Acid Sequence: AEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYT11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-39015.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SYT11 Recombinant Protein Antigen

  • DKFZp781D015
  • KIAA0080synaptotagmin 12
  • MGC10881
  • MGC17226
  • synaptotagmin XISYT12
  • synaptotagmin-11
  • sytXI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4736
Species: Hu
Applications: WB
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38121
Species: Hu
Applications: IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
MAB6047
Species: Hu
Applications: WB, ICC
NBP1-81254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
MAB6918
Species: Hu
Applications: WB
NBP2-32398
Species: Hu
Applications: IHC, IHC-P
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-39015PEP
Species: Hu
Applications: AC

Publications for SYT11 Protein (NBP2-39015PEP) (0)

There are no publications for SYT11 Protein (NBP2-39015PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYT11 Protein (NBP2-39015PEP) (0)

There are no reviews for SYT11 Protein (NBP2-39015PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SYT11 Protein (NBP2-39015PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SYT11 Protein (NBP2-39015PEP)

Discover related pathways, diseases and genes to SYT11 Protein (NBP2-39015PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYT11 Protein (NBP2-39015PEP)

Discover more about diseases related to SYT11 Protein (NBP2-39015PEP).
 

Pathways for SYT11 Protein (NBP2-39015PEP)

View related products by pathway.

PTMs for SYT11 Protein (NBP2-39015PEP)

Learn more about PTMs related to SYT11 Protein (NBP2-39015PEP).
 

Research Areas for SYT11 Protein (NBP2-39015PEP)

Find related products by research area.

Blogs on SYT11

There are no specific blogs for SYT11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LRRK2 Antibody
NB300-268
SYT11 Antibody
NBP2-39015

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SYT11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT11