Syntaxin-BP1 Antibody

Images

 
Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: Syntaxin-BP1 Antibody [NBP1-83139] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Syntaxin-BP1 Antibody [NBP1-83139] - Staining of human cerebellum shows strong positivity in neuropil.
Western Blot: Syntaxin-BP1 Antibody [NBP1-83139] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin-BP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STXBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Syntaxin-BP1 Protein (NBP1-83139PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin-BP1 Antibody

  • EIEE4
  • FLJ37475
  • hUNC18
  • MUNC18-1
  • NSEC1
  • N-Sec1
  • p67
  • Protein unc-18 homolog 1
  • Protein unc-18 homolog A
  • rbSec1
  • STXBP1
  • syntaxin binding protein 1
  • syntaxin-binding protein 1
  • SyntaxinBP1
  • Syntaxin-BP1
  • UNC18
  • unc18-1
  • UNC18A
  • unc-18A
  • UNC18neuronal SEC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Syntaxin-BP1 Antibody (NBP1-83139) (0)

There are no publications for Syntaxin-BP1 Antibody (NBP1-83139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin-BP1 Antibody (NBP1-83139) (0)

There are no reviews for Syntaxin-BP1 Antibody (NBP1-83139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin-BP1 Antibody (NBP1-83139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin-BP1 Products

Bioinformatics Tool for Syntaxin-BP1 Antibody (NBP1-83139)

Discover related pathways, diseases and genes to Syntaxin-BP1 Antibody (NBP1-83139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin-BP1 Antibody (NBP1-83139)

Discover more about diseases related to Syntaxin-BP1 Antibody (NBP1-83139).
 

Pathways for Syntaxin-BP1 Antibody (NBP1-83139)

View related products by pathway.

PTMs for Syntaxin-BP1 Antibody (NBP1-83139)

Learn more about PTMs related to Syntaxin-BP1 Antibody (NBP1-83139).

Blogs on Syntaxin-BP1

There are no specific blogs for Syntaxin-BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin-BP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP1
Entrez