Syntaxin 4 Antibody


Western Blot: Syntaxin 4 Antibody [NBP1-69179] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Syntaxin 4 Antibody Summary

Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the C terminal of STX4. Peptide sequence VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STX4 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Syntaxin 4 Antibody

  • NY-REN-31
  • p35-2
  • Renal carcinoma antigen NY-REN-31
  • STX4
  • STX4Ap35-2
  • Syntaxin 4
  • syntaxin 4A (placental)
  • syntaxin-4


STX4 is a plasma membrane t-SNARE that mediates docking of transport vesicles.STX4 is necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, STX4 may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes. STX4 may also play a role in docking of synaptic vesicles at presynaptic active zones.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P

Publications for Syntaxin 4 Antibody (NBP1-69179) (0)

There are no publications for Syntaxin 4 Antibody (NBP1-69179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 4 Antibody (NBP1-69179) (0)

There are no reviews for Syntaxin 4 Antibody (NBP1-69179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntaxin 4 Antibody (NBP1-69179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Syntaxin 4 Products

Bioinformatics Tool for Syntaxin 4 Antibody (NBP1-69179)

Discover related pathways, diseases and genes to Syntaxin 4 Antibody (NBP1-69179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 4 Antibody (NBP1-69179)

Discover more about diseases related to Syntaxin 4 Antibody (NBP1-69179).

Pathways for Syntaxin 4 Antibody (NBP1-69179)

View related products by pathway.

Blogs on Syntaxin 4

There are no specific blogs for Syntaxin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Syntaxin 4 Antibody and receive a gift card or discount.


Gene Symbol STX4