Syntaphilin Antibody

Images

 
Immunohistochemistry-Paraffin: Syntaphilin Antibody [NBP2-13358] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaphilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQ VCGTDPESGDRCPELDAHPSGPRDPNSAVVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syntaphilin Protein (NBP2-13358PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaphilin Antibody

  • bA314N13.5
  • KIAA0374
  • MGC46096
  • syntaphilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
AF5544
Species: Hu
Applications: WB
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
H00140735-M04
Species: Hu
Applications: WB, ELISA
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13358
Species: Hu
Applications: IHC, IHC-P

Publications for Syntaphilin Antibody (NBP2-13358) (0)

There are no publications for Syntaphilin Antibody (NBP2-13358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaphilin Antibody (NBP2-13358) (0)

There are no reviews for Syntaphilin Antibody (NBP2-13358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Syntaphilin Antibody (NBP2-13358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaphilin Products

Bioinformatics Tool for Syntaphilin Antibody (NBP2-13358)

Discover related pathways, diseases and genes to Syntaphilin Antibody (NBP2-13358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaphilin Antibody (NBP2-13358)

Discover more about diseases related to Syntaphilin Antibody (NBP2-13358).
 

Pathways for Syntaphilin Antibody (NBP2-13358)

View related products by pathway.

PTMs for Syntaphilin Antibody (NBP2-13358)

Learn more about PTMs related to Syntaphilin Antibody (NBP2-13358).

Blogs on Syntaphilin

There are no specific blogs for Syntaphilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaphilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNPH