Syntabulin/GOLSYN Antibody

Immunocytochemistry/Immunofluorescence: Syntabulin/GOLSYN Antibody [NBP2-30921] - Staining of human cell line CACO-2 shows localization to vesicles.

Immunohistochemistry-Paraffin: Syntabulin/GOLSYN Antibody [NBP2-30921] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Syntabulin/GOLSYN Antibody [NBP2-30921] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Syntabulin/GOLSYN Antibody [NBP2-30921] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Syntabulin/GOLSYN Antibody [NBP2-30921] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntabulin/GOLSYN Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STPGANVLELLPIVMGQEEGSVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYBU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Syntabulin/GOLSYN Protein (NBP2-30921PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Syntabulin/GOLSYN Antibody

• Golgi-Localized Protein
• Golgi-Localized Syntaphilin-Related Protein
• GOLSYN A Protein
• GOLSYN B Protein
• GOLSYN C Protein
• GOLSYN
• Implicated In Syntaxin Trafficking In Neurons
• KIAA1472
• Microtubule-Associated Protein
• OCSYN
• SNPHL
• SYBU
• Syntabulin (Syntaxin-Interacting)
• Syntabulin
• syntaphilin-like
• Syntaxin-1-Binding Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYBU
• Uniprot:
  • Q9NX95()