We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Syndecan-2/CD362 Recombinant Protein Antigen

Images

 
There are currently no images for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Syndecan-2/CD362 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Syndecan-2/CD362

Source: E.coli

Amino Acid Sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
SDC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25169It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Syndecan-2/CD362 Recombinant Protein Antigen

  • CD362 antigen
  • CD362
  • Fibroglycan
  • heparan sulfate proteoglycan 1, cell surface-associated
  • Heparan sulfate proteoglycan core protein
  • HSPG
  • HSPG1
  • HSPG1syndecan proteoglycan 2
  • SDC2
  • SYND2
  • SYND2cell surface-associated heparan sulfate proteoglycan 1
  • syndecan 2
  • Syndecan2
  • Syndecan-2

Background

Proteoglycans are macromolecules consisting of a variety of core proteins with covalently attached one or several polysaccharide chains of the glycosaminoglycan type (heparan sulphate, heparin, chondroitin sulphate, dermatan sulphate or keratan sulphate). At least two forms of basement membrane heparan sulphate proteoglycan (HSPG) have been identified. One with a large core protein (> 400 kD) and one with a small core protein (30 kD). The large HSPG is probably the most abundant basement membrane proteoglycan. It is located predominantly in the lamina lucida, where it forms clustered aggregates and interacts with other basement membrane components to form the matrix. In addition, it also plays a critical role in attachment of cells to the basal membrane via integrin receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NB100-64980
Species: Hu
Applications: Flow, Func, IHC, IHC-Fr,  IHC-P, WB
233-FB
Species: Hu
Applications: BA
NBP2-24630
Species: Hu, Mu, Pm
Applications: Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-44484
Species: Hu
Applications: Flow, ICC/IF, IF, IHC,  IHC-P, WB
AF4519
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
236-EG
Species: Hu
Applications: BA
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
7570-GH
Species: Hu
Applications: EnzAct
550-AG
Species: Rt
Applications: BA, BA
DVE00
Species: Hu
Applications: ELISA
NBP3-25169PEP
Species: Hu
Applications: AC

Publications for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP) (0)

There are no publications for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP) (0)

There are no reviews for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Syndecan-2/CD362 Products

Research Areas for Syndecan-2/CD362 Recombinant Protein Antigen (NBP3-25169PEP)

Find related products by research area.

Blogs on Syndecan-2/CD362

There are no specific blogs for Syndecan-2/CD362, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Syndecan-2/CD362 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SDC2