Syndecan-2/CD362 Antibody - Azide and BSA Free

Western Blot: Syndecan-2 Antibody [H00006383-B04P] - Analysis of SDC2 expression in transfected 293T cell line. Lane 1: SDC2 transfected lysate (20.13 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, Flow
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Syndecan-2/CD362 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SDC2 (NP_002989.2, 19 a.a. - 201 a.a.) full-length human protein. ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SDC2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syndecan-2/CD362 Antibody - Azide and BSA Free

• CD362 antigen
• CD362
• Fibroglycan
• heparan sulfate proteoglycan 1, cell surface-associated
• Heparan sulfate proteoglycan core protein
• HSPG
• HSPG1
• HSPG1syndecan proteoglycan 2
• SDC2
• SYND2
• SYND2cell surface-associated heparan sulfate proteoglycan 1
• syndecan 2
• Syndecan2
• Syndecan-2

Background

Proteoglycans are macromolecules consisting of a variety of core proteins with covalently attached one or several polysaccharide chains of the glycosaminoglycan type (heparan sulphate, heparin, chondroitin sulphate, dermatan sulphate or keratan sulphate). At least two forms of basement membrane heparan sulphate proteoglycan (HSPG) have been identified. One with a large core protein (> 400 kD) and one with a small core protein (30 kD). The large HSPG is probably the most abundant basement membrane proteoglycan. It is located predominantly in the lamina lucida, where it forms clustered aggregates and interacts with other basement membrane components to form the matrix. In addition, it also plays a critical role in attachment of cells to the basal membrane via integrin receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Syndecan-2/CD362 Antibody (H00006383-B04P)(2)

Publications using H00006383-B04P

• Lim H, Multhaupt H, Couchman JR. Cell surface heparan sulfate proteoglycans control adhesion and invasion of breast carcinoma cells. Mol Cancer. 2015-01-27 [PMID: 25623282]
• Lim HC, Couchman JR. Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases. Biochim Biophys Acta. 2014-08-01 [PMID: 24447566] (Human)

Bioinformatics

• Gene Symbol: SDC2
• Uniprot:
  • NP_002989.2(Human)