Synaptojanin 2 Antibody

Images

 
Western Blot: Synaptojanin 2 Antibody [NBP1-87843] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: Synaptojanin 2 Antibody [NBP1-87843] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: Synaptojanin 2 Antibody [NBP1-87843] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in granular layer.
Western Blot: Synaptojanin 2 Antibody [NBP1-87843] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-562
Immunocytochemistry/ Immunofluorescence: Synaptojanin 2 Antibody [NBP1-87843] - staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptojanin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HGQYSILQTARLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNJ2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Synaptojanin 2 Protein (NBP1-87843PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptojanin 2 Antibody

  • EC 3.1.3.36
  • inositol phosphate 5'-phosphatase 2
  • INPP5H
  • KIAA0348MGC44422
  • Synaptic inositol-14,5-trisphosphate 5-phosphatase 2
  • synaptojanin 2
  • synaptojanin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-94158
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-88985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-87843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Synaptojanin 2 Antibody (NBP1-87843) (0)

There are no publications for Synaptojanin 2 Antibody (NBP1-87843).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptojanin 2 Antibody (NBP1-87843) (0)

There are no reviews for Synaptojanin 2 Antibody (NBP1-87843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Synaptojanin 2 Antibody (NBP1-87843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptojanin 2 Products

Bioinformatics Tool for Synaptojanin 2 Antibody (NBP1-87843)

Discover related pathways, diseases and genes to Synaptojanin 2 Antibody (NBP1-87843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptojanin 2 Antibody (NBP1-87843)

Discover more about diseases related to Synaptojanin 2 Antibody (NBP1-87843).
 

Pathways for Synaptojanin 2 Antibody (NBP1-87843)

View related products by pathway.

PTMs for Synaptojanin 2 Antibody (NBP1-87843)

Learn more about PTMs related to Synaptojanin 2 Antibody (NBP1-87843).
 

Research Areas for Synaptojanin 2 Antibody (NBP1-87843)

Find related products by research area.

Blogs on Synaptojanin 2

There are no specific blogs for Synaptojanin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptojanin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNJ2