SWAP70 Antibody (3H8) - Azide and BSA Free

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in human spleen.

Immunohistochemistry-Paraffin: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of monoclonal antibody to SWAP70 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in PC-12 (Cat # L012V1).

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in Raw 264.7.

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in NIH/3T3 (Cat # L018V1).

Western Blot: SWAP70 Antibody (3H8) [H00023075-M09] - Analysis of SWAP70 expression in transfected 293T cell line by SWAP70 monoclonal antibody (M09), clone 3H8. Lane 1: SWAP70 transfected lysatE (69 KDa). Lane 2: Non-transfected lysate.

ELISA: SWAP70 Antibody (3H8) [H00023075-M09] - Detection limit for recombinant GST tagged SWAP70 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 3H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SWAP70 Antibody (3H8) - Azide and BSA Free Summary

• Immunogen: SWAP70 (NP_055870, 378 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQA
• Specificity: SWAP70 - SWAP-70 protein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SWAP70
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human, mouse & rat. Other species have not been tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SWAP70 Antibody (3H8) - Azide and BSA Free

• KIAA0640SWAP-70FLJ39540
• SWAP switching B-cell complex 70kDa subunit
• SWAP70
• switch-associated protein 70

Background

Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SWAP70
• Entrez:
  • 23075(Human)
• OMIM:
  • 604762(Human)
• Uniprot:
  • NP_055870(Human)