SVOP Antibody


Immunohistochemistry-Paraffin: SVOP Antibody [NBP1-84104] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SVOP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE
Specificity of human SVOP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SVOP Protein (NBP1-84104PEP)
Read Publication using NBP1-84104.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SVOP Antibody

  • DKFZp761H039
  • SV2 related protein homolog (rat)
  • SV2-related protein
  • synaptic vesicle 2-related protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SVOP Antibody (NBP1-84104)(1)

Reviews for SVOP Antibody (NBP1-84104) (0)

There are no reviews for SVOP Antibody (NBP1-84104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SVOP Antibody (NBP1-84104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SVOP Products

Bioinformatics Tool for SVOP Antibody (NBP1-84104)

Discover related pathways, diseases and genes to SVOP Antibody (NBP1-84104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SVOP Antibody (NBP1-84104)

Discover more about diseases related to SVOP Antibody (NBP1-84104).

Pathways for SVOP Antibody (NBP1-84104)

View related products by pathway.

PTMs for SVOP Antibody (NBP1-84104)

Learn more about PTMs related to SVOP Antibody (NBP1-84104).

Blogs on SVOP

There are no specific blogs for SVOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SVOP Antibody and receive a gift card or discount.


Gene Symbol SVOP