SV2B Antibody - BSA Free

Immunohistochemistry-Paraffin: SV2B Antibody [NBP1-92462] - Staining of human cerebral cortex shows distinct positivity in neuropil.

Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human kidney shows no positivity in cells in tubules as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SV2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SV2B Antibody - BSA Free (NBP1-92462) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SV2B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SV2B Protein (NBP1-92462PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SV2B Antibody - BSA Free

• FLJ30413
• FLJ42732
• HsT19680
• KIAA0735HsT19680
• SV2B
• synaptic vesicle glycoprotein 2B
• synaptic vesicle protein 2B homolog

Background

Probably plays a role in the control of regulated secretion in neural and endocrine cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SV2B