SUV420H2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SUV420H2 Antibody [NBP2-30524] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry: SUV420H2 Antibody [NBP2-30524] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUV420H2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUV420H2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUV420H2 Protein (NBP2-30524PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% GlycerolS
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUV420H2 Antibody

  • EC 2.1.1.43
  • FLJ98627
  • histone-lysine N-methyltransferase SUV420H2
  • KMT5Csuv4-20h2
  • Lysine N-methyltransferase 5C
  • MGC2705
  • Su(var)4-20 homolog 2
  • suppressor of variegation 4-20 homolog 2 (Drosophila)
  • Suppressor of variegation 4-20 homolog 2
  • Suv4-20h2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP1-97313
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-20322
Species: Hu
Applications: WB, ChIP, IP
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP

Publications for SUV420H2 Antibody (NBP2-30524) (0)

There are no publications for SUV420H2 Antibody (NBP2-30524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUV420H2 Antibody (NBP2-30524) (0)

There are no reviews for SUV420H2 Antibody (NBP2-30524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SUV420H2 Antibody (NBP2-30524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUV420H2 Products

Bioinformatics Tool for SUV420H2 Antibody (NBP2-30524)

Discover related pathways, diseases and genes to SUV420H2 Antibody (NBP2-30524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUV420H2 Antibody (NBP2-30524)

Discover more about diseases related to SUV420H2 Antibody (NBP2-30524).
 

Pathways for SUV420H2 Antibody (NBP2-30524)

View related products by pathway.

PTMs for SUV420H2 Antibody (NBP2-30524)

Learn more about PTMs related to SUV420H2 Antibody (NBP2-30524).

Blogs on SUV420H2

There are no specific blogs for SUV420H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUV420H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUV420H2
Uniprot