SURF5 Antibody

Images

 
Western Blot: SURF5 Antibody [NBP1-87818] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: SURF5 Antibody [NBP1-87818] - Staining of human kidney shows strong membranous positivity in renal glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SURF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SURF5 Protein (NBP1-87818PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SURF5 Antibody

  • Med24
  • mediator complex subunit 22SURF5surfeit 5
  • mediator of RNA polymerase II transcription subunit 22
  • MGC48682
  • surf-5
  • Surfeit locus protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2277
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP2-49421
Species: Hu
Applications: IHC, IHC-P
NBP2-13400
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006834-T01
Species: Hu
NBP1-83550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP2-56318
Species: Hu
Applications: ICC/IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP1-84377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-59448
Species: Hu
Applications: WB
NBP1-87818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SURF5 Antibody (NBP1-87818) (0)

There are no publications for SURF5 Antibody (NBP1-87818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SURF5 Antibody (NBP1-87818) (0)

There are no reviews for SURF5 Antibody (NBP1-87818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SURF5 Antibody (NBP1-87818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SURF5 Products

Bioinformatics Tool for SURF5 Antibody (NBP1-87818)

Discover related pathways, diseases and genes to SURF5 Antibody (NBP1-87818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SURF5 Antibody (NBP1-87818)

Discover more about diseases related to SURF5 Antibody (NBP1-87818).
 

Pathways for SURF5 Antibody (NBP1-87818)

View related products by pathway.

PTMs for SURF5 Antibody (NBP1-87818)

Learn more about PTMs related to SURF5 Antibody (NBP1-87818).

Blogs on SURF5

There are no specific blogs for SURF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SURF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED22