Surf6 Antibody

Images

 
Western Blot: Surf6 Antibody [NBP1-83550] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Surf6 Antibody [NBP1-83550] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: Surf6 Antibody [NBP1-83550] - Staining of human colon shows strong nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Surf6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKDAYLQSLAKKICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKAKSLGEKSPAASGARRPEAAKEEAAWASSSAGNPADGLATEPESVFALDVLRQRLHEKIQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SURF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Surf6 Protein (NBP1-83550PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Surf6 Antibody

  • FLJ30322
  • RRP14
  • SURF-6
  • surfeit 6
  • surfeit locus protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2277
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006834-T01
Species: Hu
NBP2-49421
Species: Hu
Applications: IHC, IHC-P
NBP2-13400
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19388
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Surf6 Antibody (NBP1-83550) (0)

There are no publications for Surf6 Antibody (NBP1-83550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Surf6 Antibody (NBP1-83550) (0)

There are no reviews for Surf6 Antibody (NBP1-83550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Surf6 Antibody (NBP1-83550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Surf6 Products

Bioinformatics Tool for Surf6 Antibody (NBP1-83550)

Discover related pathways, diseases and genes to Surf6 Antibody (NBP1-83550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Surf6 Antibody (NBP1-83550)

Discover more about diseases related to Surf6 Antibody (NBP1-83550).
 

Pathways for Surf6 Antibody (NBP1-83550)

View related products by pathway.

PTMs for Surf6 Antibody (NBP1-83550)

Learn more about PTMs related to Surf6 Antibody (NBP1-83550).

Blogs on Surf6

There are no specific blogs for Surf6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Surf6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SURF6