SUOX Antibody

Images

 
Western Blot: SUOX Antibody [NBP1-85873] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry: SUOX Antibody [NBP1-85873] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUOX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUOX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SUOX Protein (NBP1-85873PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUOX Antibody

  • EC 1.8.3.1
  • sulfite oxidase
  • sulfite oxidase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-935
Species: Bv
Applications: WB, ELISA, IP
AF5928
Species: Hu
Applications: WB, IHC, ICC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SUOX Antibody (NBP1-85873) (0)

There are no publications for SUOX Antibody (NBP1-85873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUOX Antibody (NBP1-85873) (0)

There are no reviews for SUOX Antibody (NBP1-85873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUOX Antibody (NBP1-85873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUOX Products

Bioinformatics Tool for SUOX Antibody (NBP1-85873)

Discover related pathways, diseases and genes to SUOX Antibody (NBP1-85873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUOX Antibody (NBP1-85873)

Discover more about diseases related to SUOX Antibody (NBP1-85873).
 

Pathways for SUOX Antibody (NBP1-85873)

View related products by pathway.

PTMs for SUOX Antibody (NBP1-85873)

Learn more about PTMs related to SUOX Antibody (NBP1-85873).
 

Research Areas for SUOX Antibody (NBP1-85873)

Find related products by research area.

Blogs on SUOX

There are no specific blogs for SUOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUOX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUOX