SULT1A3 Antibody

Images

 
Western Blot: SULT1A3 Antibody [H00006818-B02P] - Analysis of SULT1A3 expression in human liver.
Western Blot: SULT1A3 Antibody [H00006818-B02P] - Analysis of SULT1A3 expression in HepG2.
Western Blot: SULT1A3 Antibody [H00006818-B02P] - Analysis of SULT1A3 expression in transfected 293T cell line by SULT1A3 polyclonal antibody. Lane 1: SULT1A3 transfected lysate(32.45 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SULT1A3 Antibody Summary

Immunogen
SULT1A3 (NP_003157.1, 1 a.a. - 295 a.a.) full-length human protein. MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SULT1A3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB and recombinant protein with GST tag for ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SULT1A3 Antibody

  • Cytosolic Sulfotransferase 1A3
  • EC 2.8.2
  • EC 2.8.2.1
  • HAST
  • HAST3
  • M form) phenol sulfotransferase
  • MGC117469
  • Monoamine-sulfating phenol sulfotransferase
  • M-PST
  • ST1A3/ST1A4
  • STM
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
  • Sulfotransferase, monoamine-preferring
  • SULT1A3
  • Thermolabile phenol sulfotransferase
  • TL-PST

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1). Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
MAB5545
Species: Hu
Applications: WB
NBP2-76871
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7027-GT
Species: Hu
Applications: EnzAct
NBP2-58463
Species: Hu
Applications: ICC/IF, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-17923
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-31904
Species: Hu
Applications: IHC, IHC-P, WB
AF5959
Species: Hu
Applications: Neut, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
H00006818-B02P
Species: Hu
Applications: WB

Publications for SULT1A3 Antibody (H00006818-B02P) (0)

There are no publications for SULT1A3 Antibody (H00006818-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SULT1A3 Antibody (H00006818-B02P) (0)

There are no reviews for SULT1A3 Antibody (H00006818-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SULT1A3 Antibody (H00006818-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SULT1A3 Products

Bioinformatics Tool for SULT1A3 Antibody (H00006818-B02P)

Discover related pathways, diseases and genes to SULT1A3 Antibody (H00006818-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SULT1A3 Antibody (H00006818-B02P)

Discover more about diseases related to SULT1A3 Antibody (H00006818-B02P).
 

Pathways for SULT1A3 Antibody (H00006818-B02P)

View related products by pathway.

PTMs for SULT1A3 Antibody (H00006818-B02P)

Learn more about PTMs related to SULT1A3 Antibody (H00006818-B02P).

Blogs on SULT1A3

There are no specific blogs for SULT1A3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SULT1A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1A3
Entrez