SULT1A2 Antibody


Western Blot: SULT1A2 Antibody [NBP2-31904] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunohistochemistry-Paraffin: SULT1A2 Antibody [NBP2-31904] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SULT1A2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
SULT1A2 Protein (NBP2-31904PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SULT1A2 Antibody

  • Aryl sulfotransferase 2
  • arylamine sulfotransferase
  • EC 2.8.2
  • EC
  • HAST4
  • MGC142287
  • MGC142289
  • Phenol sulfotransferase 2
  • phenolic-metabolizing (P) form of PST
  • phenol-preferring phenol sulfotransferase2
  • Phenol-sulfating phenol sulfotransferase 2
  • P-PST 2
  • ST1A2
  • sulfotransferase 1A2
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
  • thermostable phenol sulfotransferase
  • TSPST2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SULT1A2 Antibody (NBP2-31904) (0)

There are no publications for SULT1A2 Antibody (NBP2-31904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SULT1A2 Antibody (NBP2-31904) (0)

There are no reviews for SULT1A2 Antibody (NBP2-31904). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SULT1A2 Antibody (NBP2-31904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SULT1A2 Antibody Products

Related Products by Gene

Bioinformatics Tool for SULT1A2 Antibody (NBP2-31904)

Discover related pathways, diseases and genes to SULT1A2 Antibody (NBP2-31904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SULT1A2 Antibody (NBP2-31904)

Discover more about diseases related to SULT1A2 Antibody (NBP2-31904).

Pathways for SULT1A2 Antibody (NBP2-31904)

View related products by pathway.

PTMs for SULT1A2 Antibody (NBP2-31904)

Learn more about PTMs related to SULT1A2 Antibody (NBP2-31904).

Blogs on SULT1A2

There are no specific blogs for SULT1A2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SULT1A2 Antibody and receive a gift card or discount.


Gene Symbol SULT1A2

Customers Who Bought This Also Bought