SULT1A2 Antibody

Images

 
Western Blot: SULT1A2 Antibody [NBP2-31904] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunohistochemistry-Paraffin: SULT1A2 Antibody [NBP2-31904] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.
Immunohistochemistry: SULT1A2 Antibody [NBP2-31904] - Skin
Immunohistochemistry: SULT1A2 Antibody [NBP2-31904] - Liver cancer
Immunohistochemistry: SULT1A2 Antibody [NBP2-31904] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

SULT1A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
SULT1A2 Protein (NBP2-31904PEP)

Alternate Names for SULT1A2 Antibody

  • Aryl sulfotransferase 2
  • arylamine sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.1
  • HAST4
  • MGC142287
  • MGC142289
  • Phenol sulfotransferase 2
  • phenolic-metabolizing (P) form of PST
  • phenol-preferring phenol sulfotransferase2
  • Phenol-sulfating phenol sulfotransferase 2
  • P-PST 2
  • ST1A2
  • STP2P-PST
  • sulfotransferase 1A2
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2
  • thermostable phenol sulfotransferase
  • TSPST2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP1-84785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-42820
Species: Hu, Mu, Rt, Rb
Applications: WB, B/N, IP
NBP2-32604
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36638
Species: Hu
Applications: IHC, IHC-P
NBP2-00486
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-18781
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-13336
Species: Hu
Applications: IHC, IHC-P
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32879
Species: Hu
Applications: WB
NBP2-31904
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SULT1A2 Antibody (NBP2-31904) (0)

There are no publications for SULT1A2 Antibody (NBP2-31904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SULT1A2 Antibody (NBP2-31904) (0)

There are no reviews for SULT1A2 Antibody (NBP2-31904). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SULT1A2 Antibody (NBP2-31904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SULT1A2 Antibody Products

Related Products by Gene

Bioinformatics Tool for SULT1A2 Antibody (NBP2-31904)

Discover related pathways, diseases and genes to SULT1A2 Antibody (NBP2-31904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SULT1A2 Antibody (NBP2-31904)

Discover more about diseases related to SULT1A2 Antibody (NBP2-31904).
 

Pathways for SULT1A2 Antibody (NBP2-31904)

View related products by pathway.

PTMs for SULT1A2 Antibody (NBP2-31904)

Learn more about PTMs related to SULT1A2 Antibody (NBP2-31904).

Blogs on SULT1A2

There are no specific blogs for SULT1A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SULT1A2
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-31904 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought