DNAJC22 Antibody

Western Blot: DNAJC22 Antibody [NBP2-58463] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: DNAJC22 Antibody [NBP2-58463] - Staining of human cell line U-2 OS shows localization to vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNAJC22 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNAJC22 Recombinant Protein Antigen (NBP2-58463PEP)

Reactivity Notes

Mouse 84%, Rat 85%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNAJC22 Antibody

• DnaJ (Hsp40) homolog, subfamily C, member 22
• dnaJ homolog subfamily C member 22
• FLJ13236
• wurst homolog
• wus

Background

DNAJC22 may function as a co-chaperone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC22