DNAJC22 Antibody

Images

 
Western Blot: DNAJC22 Antibody [NBP2-58463] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: DNAJC22 Antibody [NBP2-58463] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC22 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC22
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAJC22 Recombinant Protein Antigen (NBP2-58463PEP)

Reactivity Notes

Mouse 84%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DNAJC22 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 22
  • dnaJ homolog subfamily C member 22
  • FLJ13236
  • wurst homolog
  • wus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5829-ST
Species: Hu
Applications: EnzAct
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
D6050
Species: Hu
Applications: ELISA
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP3-16674
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2209
Species: Hu
Applications: ELISA, IHC, WB
NB100-1066
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-58463
Species: Hu
Applications: WB, ICC/IF

Publications for DNAJC22 Antibody (NBP2-58463) (0)

There are no publications for DNAJC22 Antibody (NBP2-58463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC22 Antibody (NBP2-58463) (0)

There are no reviews for DNAJC22 Antibody (NBP2-58463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC22 Antibody (NBP2-58463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC22 Products

Bioinformatics Tool for DNAJC22 Antibody (NBP2-58463)

Discover related pathways, diseases and genes to DNAJC22 Antibody (NBP2-58463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DNAJC22 Antibody (NBP2-58463)

View related products by pathway.

Blogs on DNAJC22

There are no specific blogs for DNAJC22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC22