Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen

Images

 
There are currently no images for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMF2.

Source: E. coli

Amino Acid Sequence: ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUMF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84145.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen

  • C-alpha-formyglycine-generating enzyme 2
  • C-alpha-formylglycine-generating enzyme 2
  • DKFZp566I1024
  • DKFZp686I1024
  • DKFZp686L17160
  • DKFZp781L1035
  • FGE2
  • MGC99485
  • paralog of the formylglycine-generating enzyme
  • pFGE
  • sulfatase modifying factor 2
  • sulfatase-modifying factor 2
  • SUMF2

Background

The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3680
Species: Hu
Applications: WB
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DY413
Species: Mu
Applications: ELISA
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00000473-M06
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-03848
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-76836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
MAB4675
Species: Mu
Applications: IHC, Neut, WB
NBP2-14306
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-92123
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP2-94521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3264
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-86240
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-92629
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-48736
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB

Publications for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no publications for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no reviews for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sulfatase Modifying Factor 2/SUMF2 Products

Blogs on Sulfatase Modifying Factor 2/SUMF2

There are no specific blogs for Sulfatase Modifying Factor 2/SUMF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMF2