Sulfatase 1 Antibody (1A4)

Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - SULF expression in corneal epithelial cells. RT-PCR analysis for SULF expression was performed on cDNA prepared from THCE, MCE and 293T cells transfected with pcDNA Sulf1 (S1) or pcDNA Sulf2 (S2) as positive controls. First-strand cDNA synthesis was also performed with reverse transcriptase omitted as a control for genomic DNA contamination (RT-). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0069642) licensed under a CC-BY license.

Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - Detection against Immunogen (35.86 KDa) .

Product Discontinued

Sulfatase 1 Antibody (1A4) Summary

• Immunogen: SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
• Specificity: SULF1 - sulfatase 1 (1A4)
• Isotype: IgM Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SULF1
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID 23950901)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23950901)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: Ascites
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sulfatase 1 Antibody (1A4)

• EC 3.1.6
• EC 3.1.6.-
• EC 3.1.6.14
• extracellular sulfatase Sulf-1
• FLJ30905
• FLJ38022
• FLJ41750
• hSulf-1
• KIAA1077sulfatase FP
• SULF-1
• sulfatase 1

Background

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sulfatase 1 Antibody (H00023213-M01A)(2)

Publications using H00023213-M01A

• Solari V, Borriello L, Turcatel G et al. MYCN-dependent Expression of Sulfatase-2 Regulates Neuroblastoma Cell Survival Cancer Res. 2014-08-27 [PMID: 25164011]
• Maltseva I, Chan M, Kalus I et al. The SULFs, Extracellular Sulfatases for Heparan Sulfate, Promote the Migration of Corneal Epithelial Cells during Wound Repair. PLoS One. 2013-08-08 [PMID: 23950901] (WB, IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: SULF1
• Entrez:
  • 23213(Human)
• Uniprot:
  • NP_055985.2(Human)