Sulfatase 1 Antibody (1A4)

Images

 
Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - SULF expression in corneal epithelial cells. RT-PCR analysis for SULF expression was performed on cDNA prepared from THCE, MCE and 293T cells transfected with ...read more
Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - Detection against Immunogen (35.86 KDa).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Sulfatase 1 Antibody (1A4) Summary

Immunogen
SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Specificity
SULF1 - sulfatase 1 (1A4)
Isotype
IgM Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SULF1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID 23950901)
Publications
Read Publications using
H00023213-M01A in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23950901)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sulfatase 1 Antibody (1A4)

  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.14
  • extracellular sulfatase Sulf-1
  • FLJ30905
  • FLJ38022
  • FLJ41750
  • hSulf-1
  • KIAA1077sulfatase FP
  • SULF-1
  • sulfatase 1

Background

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44448
Species: Hu, Mu, Po, Bv, Fi, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, IF
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF5057
Species: Hu
Applications: WB
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-37483
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00023213-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC

Publications for Sulfatase 1 Antibody (H00023213-M01A)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Sulfatase 1 Antibody (H00023213-M01A) (0)

There are no reviews for Sulfatase 1 Antibody (H00023213-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase 1 Antibody (H00023213-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Sulfatase 1 Products

Bioinformatics Tool for Sulfatase 1 Antibody (H00023213-M01A)

Discover related pathways, diseases and genes to Sulfatase 1 Antibody (H00023213-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase 1 Antibody (H00023213-M01A)

Discover more about diseases related to Sulfatase 1 Antibody (H00023213-M01A).
 

Pathways for Sulfatase 1 Antibody (H00023213-M01A)

View related products by pathway.

PTMs for Sulfatase 1 Antibody (H00023213-M01A)

Learn more about PTMs related to Sulfatase 1 Antibody (H00023213-M01A).
 

Research Areas for Sulfatase 1 Antibody (H00023213-M01A)

Find related products by research area.

Blogs on Sulfatase 1

There are no specific blogs for Sulfatase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sulfatase 1 Antibody (1A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SULF1
Entrez
Uniprot