Home » Sulfatase 1 » Sulfatase 1 Antibodies » Sulfatase 1 Antibody (1A4)

Sulfatase 1 Antibody (1A4)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - SULF expression in corneal epithelial cells. RT-PCR analysis for SULF expression was performed on cDNA prepared from THCE, MCE and 293T cells transfected with pcDNA Sulf1 (S1) or pcDNA Sulf2 (S2) as positive controls. First-strand cDNA synthesis was also performed with reverse transcriptase omitted as a control for genomic DNA contamination (RT-). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0069642) licensed under a CC-BY licence.
Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - SULF expression in corneal epithelial cells. RT-PCR analysis for SULF expression was performed on cDNA prepared from THCE, MCE and 293T cells transfected with ...read more
Western Blot: Sulfatase 1 Antibody (1A4) [H00023213-M01A] - Detection against Immunogen (35.86 KDa).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Sulfatase 1 Antibody (1A4) Summary

Immunogen
SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
Specificity
SULF1 - sulfatase 1 (1A4)
Isotype
IgM Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SULF1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry reported in scientific literature (PMID 23950901)
Publications
Read Publications using
H00023213-M01A in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23950901)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sulfatase 1 Antibody (1A4)

  • EC 3.1.6
  • EC 3.1.6.-
  • EC 3.1.6.14
  • extracellular sulfatase Sulf-1
  • FLJ30905
  • FLJ38022
  • FLJ41750
  • hSulf-1
  • KIAA1077sulfatase FP
  • SULF-1
  • sulfatase 1

Background

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sulfatase-2/SULF2
Antibody (2B4)
NBP1-36727
Western Blot: Sulfatase-2/SULF2 Antibody (2B4) [NBP1-36727] - Analysis showing Sulfatase 2 expression in MCF7 conditioned media (CM). In CM, the 75 kDa band is dominant (Tang R, Rosen SD. J Biol Chem. 2009 Aug 7;284(32):21505-14). Image courtesy of Mark Singer at UCSF.
Immunohistochemistry-Paraffin: Sulfatase-2/SULF2 Antibody (2B4) [NBP1-36727] - Immunohistochemical analysis of Sulfatase 2 in non-small-cell lung carcinoma. (left) lung squamous cell carcinoma stained with 2B4 antibody and (right) tumor-associated stromal cells stained with 2B4 antibody. Image courtesy of Mark Singer at UCSF.
Flow Cytometry: Sulfatase-2/SULF2 Antibody (2B4) [NBP1-36727] - Analysis using the FITC conjugate of NBP1-36727. Staining of Human lung cancer line with Sulfatase2-FITC. Image from verified customer review.
(6 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(403 Publications)
Species: Hu
NIK/MAP3K14
Antibody
NBP2-23603
Western Blot: NIK/MAP3K14 Antibody [NBP2-23603] - Detection of MAP3K14 in U2OS cell lysate.
Immunocytochemistry/Immunofluorescence: NIK/MAP3K14 Antibody [NBP2-23603] - MAP3K14 antibody was tested in U2OS cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: NIK/MAP3K14 Antibody [NBP2-23603] - Analysis of MAP3K14 in mouse small intestine.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Endorepellin/Perlecan/ ...
NBP2-44448
Immunohistochemistry-Paraffin: Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A7L6) [NBP2-44448] - Formalin-fixed, paraffin-embedded human Colon Carcinoma stained with Heparan Sulfate Monoclonal Antibody (A7L6).
(1 Publication)
Species: Hu, Mu, Po, Bv, Fi, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, IF
Syndecan-2/CD362
Antibody [Unconjugate ...
AF6585
Western blot shows lysates of C2C12 mouse myoblast cell line, Balb/3T3 mouse embryonic fibroblast cell line, and B16‑F1 mouse melanoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Syndecan-2/CD362 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6585) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Syndecan-2/CD362 at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Syndecan-2/CD362 was detected in perfusion fixed frozen sections of mouse spinal cord using Sheep Anti-Mouse Syndecan-2/CD362 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6585) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to the dorsal horn. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
NIH-3T3 mouse cell line was stained with Sheep Anti-Mouse Syndecan-2/CD362 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6585, filled histogram) or control antibody (Catalog # 5‑001‑A, open histogram), followed by Allophycocyanin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0127). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(35 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
HGF [Unconjugated]
294-HG
Measured by its ability to induce IL-11 secretion by Saos‑2 human osteosarcoma cells. The ED50 for this effect is 0.1‑0.5 ng/mL.
(5 Reviews)
(94 Publications)
Species: Hu
VEGF [HRP]
DVE00
(26 Reviews)
(547 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Sonic Hedgehog/Shh
[Unconjugated]
464-SH/CF
Recombinant Mouse Sonic Hedgehog/Shh (C25Il), N-Terminus (Catalog # 464-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The activity is more than 30-fold greater than the top competitor's Sonic Hedgehog.
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh (C25Il), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
(44 Publications)
Species: Mu
Recombinant Human
FGF-13 Protein
NBP2-35009
SDS-Page: Human FGF-13 Protein [NBP2-35009]
(2 Publications)
Species: Hu
Heparan Sulfate
6-O-Sulfotransferase ...
AF5057
Western blot shows lysates of H4 human neuroglioma cell line. PVDF Membrane was probed with 1 µg/mL of Human HS6ST1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5057) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for HS6ST1 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
HB-EGF
259-HE
HB-EGF
(1 Review)
(54 Publications)
Species: Hu
TCF-2/HNF-1 beta
Antibody
NBP1-89680
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney and lymph node tissues. Corresponding HNF1B RNA-seq data are presented for the same tissues.
Western Blot: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney tissue.
Immunocytochemistry/Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
Tenascin C
Antibody (4C8MS)
NB110-68136
Flow (Intracellular): Tenascin C Antibody (4C8MS) [NB110-68136] - Figure A: Intracellular stain performed on U87MG Cells with Tenascin C (4C8MS) antibody NB110-68136 (blue) and a matched isotype control NBP1-97005 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].Figure B: U87MG Cells were either untreated (orange) or treated with 3uM Monensin (blue). An intracellular stain was performed with Tenascin C (4C8MS) antibody NB110-68136. Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].
Western Blot: Tenascin C Antibody (4C8MS) [NB110-68136] - Regulation of Tenascin C expression and its effect on fibrotic responses. Confluent foreskin fibroblasts were incubated with TGF-beta (10 ng ml-1 or indicated concentrations) or Tenascin C (TNC) for 24 or 72 h or indicated periods. Whole-cell lysates, culture media and RNA were examined by western analysis (upper panels) and qPCR (lower panel). Representative immunoblots or qPCR results (means+/-s.e.m. of triplicate determinations). S, secreted; L, lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11703), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Glypican 3
Antibody (9C2)
NBP2-37483
Western Blot: Glypican 3 Antibody (9C2) [NBP2-37483] - Analysis using GPC3 mouse mAb against HepG2 (1), HEK293 (2), Jurkat (3), SK-N-SH (4), PC-12 (5), F9 (6)and Mouse liver (7) cell lysate.
Immunocytochemistry/Immunofluorescence: Glypican 3 Antibody (9C2) [NBP2-37483] - Analysis of HeLa cells using GPC3 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Glypican 3 Antibody (9C2) [NBP2-37483] - Analysis of breast cancer tissues using GPC3 mouse mAb with DAB staining.
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Sulfatase 1
Antibody (1A4)
H00023213-M01A
Sulfatase 1 Antibody (1A4)
Species: Hu, Mu
Applications: WB, ELISA, IHC

Publications for Sulfatase 1 Antibody (H00023213-M01A)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Sulfatase 1 Antibody (H00023213-M01A) (0)

There are no reviews for Sulfatase 1 Antibody (H00023213-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase 1 Antibody (H00023213-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Sulfatase 1 Products

Bioinformatics Tool for Sulfatase 1 Antibody (H00023213-M01A)

Discover related pathways, diseases and genes to Sulfatase 1 Antibody (H00023213-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase 1 Antibody (H00023213-M01A)

Discover more about diseases related to Sulfatase 1 Antibody (H00023213-M01A).
 

Pathways for Sulfatase 1 Antibody (H00023213-M01A)

View related products by pathway.

PTMs for Sulfatase 1 Antibody (H00023213-M01A)

Learn more about PTMs related to Sulfatase 1 Antibody (H00023213-M01A).
 

Research Areas for Sulfatase 1 Antibody (H00023213-M01A)

Find related products by research area.

Blogs on Sulfatase 1

There are no specific blogs for Sulfatase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sulfatase 1 Antibody (1A4) and receive a gift card or discount.


Bioinformatics

Gene Symbol SULF1
Entrez
Uniprot