SUGT1 Antibody

Images

 
Western Blot: SUGT1 Antibody [NBP2-38518] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry: SUGT1 Antibody [NBP2-38518] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUGT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK
Specificity
Specificity of human SUGT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUGT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
SUGT1 Lysate (NBP2-66147)
Control Peptide
SUGT1 Protein (NBP2-38518PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUGT1 Antibody

  • Protein 40-6-3
  • putative 40-6-3 protein
  • SGT1
  • SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
  • SGT1B protein
  • suppressor of G2 allele of SKP1 homolog
  • suppressor of G2 allele of SKP1, S. cerevisiae, homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2740
Species: Hu
Applications: WB, IHC
MAB7357
Species: Hu
Applications: WB
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
NBP1-78304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-20224
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IHC
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-38518
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUGT1 Antibody (NBP2-38518) (0)

There are no publications for SUGT1 Antibody (NBP2-38518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUGT1 Antibody (NBP2-38518) (0)

There are no reviews for SUGT1 Antibody (NBP2-38518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUGT1 Antibody (NBP2-38518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SUGT1 Antibody (NBP2-38518)

Discover related pathways, diseases and genes to SUGT1 Antibody (NBP2-38518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUGT1 Antibody (NBP2-38518)

Discover more about diseases related to SUGT1 Antibody (NBP2-38518).
 

Pathways for SUGT1 Antibody (NBP2-38518)

View related products by pathway.

PTMs for SUGT1 Antibody (NBP2-38518)

Learn more about PTMs related to SUGT1 Antibody (NBP2-38518).
 

Research Areas for SUGT1 Antibody (NBP2-38518)

Find related products by research area.

Blogs on SUGT1

There are no specific blogs for SUGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGT1
Uniprot