SUGT1 Antibody


Western Blot: SUGT1 Antibody [NBP2-38518] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry: SUGT1 Antibody [NBP2-38518] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SUGT1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK
Specificity of human SUGT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
SUGT1 Lysate (NBP2-66147)
Control Peptide
SUGT1 Protein (NBP2-38518PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SUGT1 Antibody

  • Protein 40-6-3
  • putative 40-6-3 protein
  • SGT1
  • SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
  • SGT1B protein
  • suppressor of G2 allele of SKP1 homolog
  • suppressor of G2 allele of SKP1, S. cerevisiae, homolog of


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUGT1 Antibody (NBP2-38518) (0)

There are no publications for SUGT1 Antibody (NBP2-38518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUGT1 Antibody (NBP2-38518) (0)

There are no reviews for SUGT1 Antibody (NBP2-38518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SUGT1 Antibody (NBP2-38518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SUGT1 Antibody (NBP2-38518)

Discover related pathways, diseases and genes to SUGT1 Antibody (NBP2-38518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUGT1 Antibody (NBP2-38518)

Discover more about diseases related to SUGT1 Antibody (NBP2-38518).

Pathways for SUGT1 Antibody (NBP2-38518)

View related products by pathway.

PTMs for SUGT1 Antibody (NBP2-38518)

Learn more about PTMs related to SUGT1 Antibody (NBP2-38518).

Research Areas for SUGT1 Antibody (NBP2-38518)

Find related products by research area.

Blogs on SUGT1

There are no specific blogs for SUGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SUGT1 Antibody and receive a gift card or discount.


Gene Symbol SUGT1