SUGT1 Antibody

Images

 
Western Blot: SUGT1 Antibody [H00010910-D01P] - Analysis of SUGT1 expression in transfected 293T cell line by SUGT1 polyclonal antibody.Lane 1: SUGT1 transfected lysate(37.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUGT1 Antibody Summary

Immunogen
SUGT1 (NP_006695.1, 1 a.a. - 333 a.a.) full-length human protein. MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Specificity
SUGT1 - SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUGT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUGT1 Antibody

  • Protein 40-6-3
  • putative 40-6-3 protein
  • SGT1
  • SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
  • SGT1B protein
  • suppressor of G2 allele of SKP1 homolog
  • suppressor of G2 allele of SKP1, S. cerevisiae, homolog of

Background

This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
255-SC/CF
Species: Hu
Applications: BA
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87104
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2740
Species: Hu
Applications: IHC, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-75686
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56467
Species: Ca, Hu, Pm
Applications: WB
NBP1-78304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00002491-B01P
Species: Hu
Applications: ICC/IF, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00006187-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00010910-D01P
Species: Hu
Applications: WB

Publications for SUGT1 Antibody (H00010910-D01P) (0)

There are no publications for SUGT1 Antibody (H00010910-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUGT1 Antibody (H00010910-D01P) (0)

There are no reviews for SUGT1 Antibody (H00010910-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUGT1 Antibody (H00010910-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUGT1 Products

Bioinformatics Tool for SUGT1 Antibody (H00010910-D01P)

Discover related pathways, diseases and genes to SUGT1 Antibody (H00010910-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUGT1 Antibody (H00010910-D01P)

Discover more about diseases related to SUGT1 Antibody (H00010910-D01P).
 

Pathways for SUGT1 Antibody (H00010910-D01P)

View related products by pathway.

PTMs for SUGT1 Antibody (H00010910-D01P)

Learn more about PTMs related to SUGT1 Antibody (H00010910-D01P).
 

Research Areas for SUGT1 Antibody (H00010910-D01P)

Find related products by research area.

Blogs on SUGT1

There are no specific blogs for SUGT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUGT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUGT1
Entrez
Uniprot