STT3B Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STT3B (NP_849193.1). MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
STT3B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL.
- Western Blot 1:1000 - 1:5000
|
| Theoretical MW |
94 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for STT3B Antibody - Azide and BSA Free
Background
The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: Dual ISH-IHC, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB, ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for STT3B Antibody (NBP2-93315) (0)
There are no publications for STT3B Antibody (NBP2-93315).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STT3B Antibody (NBP2-93315) (0)
There are no reviews for STT3B Antibody (NBP2-93315).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STT3B Antibody (NBP2-93315) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional STT3B Products
Blogs on STT3B