STT3B Antibody - Azide and BSA Free

Western Blot: STT3B Antibody - Azide and BSA Free [NBP2-93315] - Western blot analysis of lysates from HUH-7 cells, using STT3B Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

STT3B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit STT3B Antibody - Azide and BSA Free (NBP2-93315) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human STT3B (NP_849193.1). MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STT3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 94 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for STT3B Antibody - Azide and BSA Free

• FLJ90106
• homolog of yeast STT3
• Oligosaccharyl transferase subunit STT3B
• SIMPEC 2.4.1.119
• source of immunodominant MHC associated peptides
• Source of immunodominant MHC-associated peptides homolog
• STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
• STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Background

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: STT3B