STT3B Antibody


Immunocytochemistry/ Immunofluorescence: STT3B Antibody [NBP1-81884] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: STT3B Antibody [NBP1-81884] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

STT3B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STT3B Protein (NBP1-81884PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for STT3B Antibody

  • FLJ90106
  • homolog of yeast STT3
  • Oligosaccharyl transferase subunit STT3B
  • source of immunodominant MHC associated peptides
  • Source of immunodominant MHC-associated peptides homolog
  • STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
  • STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for STT3B Antibody (NBP1-81884) (0)

There are no publications for STT3B Antibody (NBP1-81884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STT3B Antibody (NBP1-81884) (0)

There are no reviews for STT3B Antibody (NBP1-81884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STT3B Antibody (NBP1-81884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional STT3B Products

STT3B NBP1-81884

Bioinformatics Tool for STT3B Antibody (NBP1-81884)

Discover related pathways, diseases and genes to STT3B Antibody (NBP1-81884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STT3B Antibody (NBP1-81884)

Discover more about diseases related to STT3B Antibody (NBP1-81884).

Pathways for STT3B Antibody (NBP1-81884)

View related products by pathway.

PTMs for STT3B Antibody (NBP1-81884)

Learn more about PTMs related to STT3B Antibody (NBP1-81884).

Blogs on STT3B

There are no specific blogs for STT3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STT3B Antibody and receive a gift card or discount.


Gene Symbol STT3B