STT3B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: STT3B Antibody [NBP1-81884] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: STT3B Antibody [NBP1-81884] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STT3B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STT3B Antibody - BSA Free (NBP1-81884) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
• Predicted Species: Mouse (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STT3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STT3B Protein (NBP1-81884PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STT3B Antibody - BSA Free

• FLJ90106
• homolog of yeast STT3
• Oligosaccharyl transferase subunit STT3B
• SIMPEC 2.4.1.119
• source of immunodominant MHC associated peptides
• Source of immunodominant MHC-associated peptides homolog
• STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
• STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Background

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STT3B