STRBP Antibody - BSA Free

Western Blot: STRBP Antibody [NBP1-57311] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

STRBP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to STRBP(spermatid perinuclear RNA binding protein) The peptide sequence was selected from the middle region of STRBP. Peptide sequence PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STRBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for STRBP Antibody - BSA Free

• DKFZp434N214
• FLJ11307
• FLJ14223
• FLJ14984
• ILF3L
• interleukin enhancer binding factor 3-like
• MGC21529
• MGC3405
• p74
• spermatid perinuclear RNA binding protein
• spermatid perinuclear RNA-binding protein
• SPNRFLJ21960

Background

STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STRBP
• Uniprot:
  • Q96SI9(Human)