STRA8 Antibody - BSA Free

Staining of human cell line U2OS shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STRA8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STRA8 Antibody - BSA Free (NBP3-25164) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein STRA8 using the following amino acid sequence: FDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STRA8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STRA8 Antibody - BSA Free

• stimulated by retinoic acid gene 8 homolog (mouse)
• stimulated by retinoic acid gene 8 protein homolog

Background

STRA8 is required for the transition into meiosis for both female and male germ cells. In female germ cells, requiredfor premeiotic DNA replication and subsequent events in meiotic prophase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STRA8