STK39 Antibody (0D9L5)

Western Blot: STK39 Antibody (0D9L5) [NBP3-16104] - Western blot analysis of extracts of Mouse testis, using STK39 Rabbit mAb (NBP3-16104) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: STK39 Antibody (0D9L5) [NBP3-16104] - Western blot analysis of extracts of various cell lines, using STK39 Rabbit mAb (NBP3-16104) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: STK39 Antibody (0D9L5) [NBP3-16104] - Immunohistochemistry of paraffin-embedded human placenta using STK39 Rabbit mAb (NBP3-16104) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: STK39 Antibody (0D9L5) [NBP3-16104] - Confocal imaging of NIH/3T3 cells using STK39 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: STK39 Antibody (0D9L5) [NBP3-16104] - Confocal imaging of Hep G2 cells using STK39 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: STK39 Antibody (0D9L5) [NBP3-16104] - Confocal imaging of human colon using STK39 Rabbit mAb . Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 0D9L5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

STK39 Antibody (0D9L5) Summary

• Description: Novus Biologicals Rabbit STK39 Antibody (0D9L5) (NBP3-16104) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 401-545 of human STK39 (Q9UEW8). SQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQLSVS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STK39
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STK39 Antibody (0D9L5)

• DCHTsmall intestine SPAK-like kinase
• DKFZp686K05124
• EC 2.7.11
• EC 2.7.11.1
• PASK
• proline-alanine-rich STE20-related kinase
• serine threonine kinase 39
• Serine/threonine-protein kinase 39
• SPAKserine threonine kinase 39 (STE20/SPS1 homolog, yeast)
• STE20/SPS1 homolog
• STE20/SPS1-related proline-alanine-rich protein kinase
• Ste20-like protein kinase
• Ste-20-related kinase

Background

STK39 encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK39