STK11IP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: STK11IP Antibody [NBP2-58347] - Staining of human cell line HeLa shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STK11IP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVLEPDAHAAVQELLAVLTPVTNVAREQLGEARDLLLGRFQCLRCGHEFKPEEPRMGLDSEEGWRPLFQKTESPAVC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK11IP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STK11IP Recombinant Protein Antigen (NBP2-58347PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STK11IP Antibody - BSA Free

• KIAA1898LKB1 interacting protein
• LIP1serine/threonine kinase 11-interacting protein
• LKB1-interacting protein 1
• LKB1IPserine/threonine-protein kinase 11-interacting protein
• serine/threonine kinase 11 interacting protein
• STK11IP1STK11 interacting protein

Background

Serine/threonine kinase 11-interacting protein (STK11IP) is a leucine-rich repeat containing protein found to interact with the STK11 serine/threonine kinase. STK11IP is implicated to regulate STK11 function by controlling its subcellular localization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK11IP