![Western Blot: STIL Antibody [NBP2-93458] - Analysis of extracts of various cell lines, using STIL at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.](http://images.novusbio.com/fullsize/STIL-Antibody-Western-Blot-NBP2-93458-img0001.jpg "Western Blot: STIL Antibody [NBP2-93458] - Analysis of extracts of various cell lines, using STIL at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.")
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STIL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for STIL Antibody (NBP2-93458)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STIL |
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
