STI1 Antibody

Images

 
Western Blot: STI1 Antibody [NBP2-32621] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: STI1 Antibody [NBP2-32621] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: STI1 Antibody [NBP2-32621] - Staining of human testis shows strong cytoplasmic positivity in basal cells of the seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STI1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STI1 Protein (NBP2-32621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STI1 Antibody

  • HOP
  • HOPSTI1L
  • Hsc70/Hsp90-organizing protein
  • Hsp70/Hsp90-organizing protein
  • IEF-SSP-3521
  • NY-REN-11 antigen
  • NY-REN-11
  • Renal carcinoma antigen NY-REN-11
  • STI1
  • STI1L
  • STI1P60
  • STIP1
  • stress-induced-phosphoprotein 1
  • Transformation-sensitive protein IEF SSP 3521

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF7250
Species: Hu
Applications: IHC
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF771
Species: Mu
Applications: WB, IHC, Neut
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STI1 Antibody (NBP2-32621) (0)

There are no publications for STI1 Antibody (NBP2-32621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STI1 Antibody (NBP2-32621) (0)

There are no reviews for STI1 Antibody (NBP2-32621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STI1 Antibody (NBP2-32621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STI1 Products

Bioinformatics Tool for STI1 Antibody (NBP2-32621)

Discover related pathways, diseases and genes to STI1 Antibody (NBP2-32621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STI1 Antibody (NBP2-32621)

Discover more about diseases related to STI1 Antibody (NBP2-32621).
 

Pathways for STI1 Antibody (NBP2-32621)

View related products by pathway.

PTMs for STI1 Antibody (NBP2-32621)

Learn more about PTMs related to STI1 Antibody (NBP2-32621).
 

Research Areas for STI1 Antibody (NBP2-32621)

Find related products by research area.

Blogs on STI1

There are no specific blogs for STI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STI1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STIP1
Entrez