Recombinant Human Sterol carrier protein 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Sterol carrier protein 2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human SCP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SCP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sterol carrier protein 2 Protein

  • DKFZp686C12188
  • DKFZp686D11188
  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCP-CHI
  • SCPX
  • SCP-X
  • sterol carrier protein 2EC 2.3.1.176
  • Sterol carrier protein X

Background

SCP2( AAH05911, 1 a.a. - 144 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006342-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no publications for Sterol carrier protein 2 Recombinant Protein (H00006342-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no reviews for Sterol carrier protein 2 Recombinant Protein (H00006342-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sterol carrier protein 2 Products

Bioinformatics Tool for Sterol carrier protein 2 Recombinant Protein (H00006342-P01)

Discover related pathways, diseases and genes to Sterol carrier protein 2 Recombinant Protein (H00006342-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sterol carrier protein 2 Recombinant Protein (H00006342-P01)

Discover more about diseases related to Sterol carrier protein 2 Recombinant Protein (H00006342-P01).
 

Pathways for Sterol carrier protein 2 Recombinant Protein (H00006342-P01)

View related products by pathway.

PTMs for Sterol carrier protein 2 Recombinant Protein (H00006342-P01)

Learn more about PTMs related to Sterol carrier protein 2 Recombinant Protein (H00006342-P01).

Blogs on Sterol carrier protein 2

There are no specific blogs for Sterol carrier protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SCP1 Antibody
NB300-229

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sterol carrier protein 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCP2