Novus Biologicals products are now on bio-techne.com

Recombinant Human Sterol carrier protein 2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Sterol carrier protein 2 Protein [H00006342-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human Sterol carrier protein 2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human SCP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SCP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
41.47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sterol carrier protein 2 GST (N-Term) Protein

  • DKFZp686C12188
  • DKFZp686D11188
  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCP-CHI
  • SCPX
  • SCP-X
  • sterol carrier protein 2EC 2.3.1.176
  • Sterol carrier protein X

Background

SCP2( AAH05911, 1 a.a. - 144 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87695
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NB100-93444
Species: Hu
Applications: PEP-ELISA, WB
H00055974-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-03456
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-25696
Species: Ca, Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
AF1476
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00006342-P01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no publications for Sterol carrier protein 2 Recombinant Protein (H00006342-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no reviews for Sterol carrier protein 2 Recombinant Protein (H00006342-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sterol carrier protein 2 Recombinant Protein (H00006342-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sterol carrier protein 2 Products

Blogs on Sterol carrier protein 2

There are no specific blogs for Sterol carrier protein 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sterol carrier protein 2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCP2