Staufen Recombinant Protein Antigen

Images

 
There are currently no images for Staufen Recombinant Protein Antigen (NBP3-17204PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Staufen Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Staufen

Source: E. coli

Amino Acid Sequence: ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STAU1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17204.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Staufen Recombinant Protein Antigen

  • double-stranded RNA-binding protein Staufen homolog 1
  • FLJ25010
  • RNA binding protein (Drosophila)
  • RNA-binding protein)
  • staufen, RNA binding protein, homolog 1 (Drosophila)

Background

Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89380
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP3-38288
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-30321
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
AF2030
Species: Hu
Applications: IHC, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-79842
Species: Hu, Mu
Applications: IP, WB
NBP3-45831
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP3-46475
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-94094
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17204PEP
Species: Hu
Applications: AC

Publications for Staufen Recombinant Protein Antigen (NBP3-17204PEP) (0)

There are no publications for Staufen Recombinant Protein Antigen (NBP3-17204PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Staufen Recombinant Protein Antigen (NBP3-17204PEP) (0)

There are no reviews for Staufen Recombinant Protein Antigen (NBP3-17204PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Staufen Recombinant Protein Antigen (NBP3-17204PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Staufen Products

Research Areas for Staufen Recombinant Protein Antigen (NBP3-17204PEP)

Find related products by research area.

Blogs on Staufen.

Staufen1 Overabundance and the Consequent mTOR Hyperactivity in Amyotrophic Lateral Sclerosis, Spinocerebellar Ataxia Type 2, Alzheimer’s, Parkinson’s, and Huntington’s Diseases
Jamshed Arslan, Pharm D, PhD Neurodegenerative disorders involve loss of function and, ultimately, death of neurons. Selective neuronal vulnerability has been observed in a variety of neurodegenerative diseases. Fo...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Staufen Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STAU1