STAU2 Antibody

Images

 
Western Blot: STAU2 Antibody [NBP1-89380] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: STAU2 Antibody [NBP1-89380] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: STAU2 Antibody [NBP1-89380] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: STAU2 Antibody [NBP1-89380] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell bodies and processes.
Immunohistochemistry-Paraffin: STAU2 Antibody [NBP1-89380] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAU2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAU2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STAU2 Protein (NBP1-89380PEP)
Publications
Read Publication using NBP1-89380.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23524536)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAU2 Antibody

  • DKFZp781K0371,39K2
  • double-stranded RNA-binding protein Staufen homolog 2,39K3
  • MGC119606
  • staufen (Drosophila, RNA-binding protein) homolog 2
  • staufen homolog 2
  • staufen, RNA binding protein, homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33202
Species: Hu, Mu
Applications: WB, IP
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
AF3795
Species: Hu
Applications: WB, IP
NB100-387
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1059
Species: Hu, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-89606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1759
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-368
Species: Hu
Applications: WB
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for STAU2 Antibody (NBP1-89380)(1)

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for STAU2 Antibody (NBP1-89380) (0)

There are no reviews for STAU2 Antibody (NBP1-89380). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAU2 Antibody (NBP1-89380) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAU2 Products

Bioinformatics Tool for STAU2 Antibody (NBP1-89380)

Discover related pathways, diseases and genes to STAU2 Antibody (NBP1-89380). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAU2 Antibody (NBP1-89380)

Discover more about diseases related to STAU2 Antibody (NBP1-89380).
 

Pathways for STAU2 Antibody (NBP1-89380)

View related products by pathway.

PTMs for STAU2 Antibody (NBP1-89380)

Learn more about PTMs related to STAU2 Antibody (NBP1-89380).

Blogs on STAU2

There are no specific blogs for STAU2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAU2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAU2