STAU2 Antibody - BSA Free

Immunohistochemistry-Paraffin: STAU2 Antibody [NBP1-89380] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: STAU2 Antibody [NBP1-89380] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell bodies and processes.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line MOLT-4.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STAU2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STAU2 Antibody - BSA Free (NBP1-89380) is a polyclonal antibody validated for use in IHC, WB and IP. Anti-STAU2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQ
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAU2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reactivity reported in (PMID: 23524536).
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  STAU2 Protein (NBP1-89380PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STAU2 Antibody - BSA Free

• DKFZp781K0371,39K2
• double-stranded RNA-binding protein Staufen homolog 2,39K3
• MGC119606
• staufen (Drosophila, RNA-binding protein) homolog 2
• staufen homolog 2
• staufen, RNA binding protein, homolog 2 (Drosophila)

Background

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STAU2 Antibody (NBP1-89380)(1)

Publication using NBP1-89380

• Gleghorn ML, Gong C, Kielkopf CL, Maquat LE. Staufen1 dimerizes via a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay. Nat Struct Mol Biol 2013-04-01 [PMID: 23524536] (IP, WB)

Bioinformatics

• Gene Symbol: STAU2