Stathmin 1 Antibody (7Y7H4)

Images

 
Western Blot: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Western blot analysis of extracts of various cell lines, using Stathmin 1 Rabbit mAb (NBP3-16396) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Confocal imaging of HeLa cells using Stathmin 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The ...read more
Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Confocal imaging of paraffin-embedded Mouse brain using Stathmin 1 Rabbit mAb followed by a further incubation with Cy3 Goat ...read more
Immunocytochemistry/ Immunofluorescence: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Confocal imaging of paraffin-embedded Rat brain using Stathmin 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Human colon using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Human testis using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Rat colon using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more
Immunohistochemistry: Stathmin 1 Antibody (7Y7H4) [NBP3-16396] - Immunohistochemistry analysis of paraffin-embedded Mouse intestin using Stathmin 1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clone
7Y7H4
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Stathmin 1 Antibody (7Y7H4) Summary

Description
Novus Biologicals Rabbit Stathmin 1 Antibody (7Y7H4) (NBP3-16396) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949). KQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Source
HEK293
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
STMN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Stathmin 1 Antibody (7Y7H4)

  • C1orf215
  • chromosome 1 open reading frame 215
  • Lag
  • Leukemia-associated phosphoprotein p18
  • metablastin
  • MGC138869
  • Oncoprotein 18
  • Op18
  • OP18MGC138870
  • phosphoprotein 19
  • Phosphoprotein p19
  • PP17
  • PP19
  • PR22
  • prosolin
  • Protein Pr22
  • SMNLAP18FLJ32206
  • stathmin 1
  • stathmin 1/oncoprotein 18
  • stathmin
  • transmembrane protein C1orf215

Background

Stathmin (oncoprotein 18, op18) is a ubiquitous cytosolic phosphoprotein with various regulatory functions in cell proliferation, differentiation signaling, and activation (1). In particular, stathmin is involved in the regulation of tubulin dynamics through inhibition of microtubule formation and/or microtubule depolymerization. Stathmin interacts with soulable tubulins (alpha,beta-tubulin) resulting in the formation of T2S complex which sequesters free tubulin, impeding tubulin formation (2). Stathmin activity is regulated through phosphorylation at Ser16, Ser25, Ser38 and Ser63 by various protein kinases (e.g. MAP-kinase, p34cdc2 kinase), weakening stathmin's affinity to tubulin (3). A mutation on stathmin can lead to excess build up of mitotic spindle and with possible consequence of unregulated cell cycles seen in cancer cells (4). Stathmin is also known as the generic member of a protein family which includes neural proteins SCG10, SCLIP and RB3/RB3/RB3. All members in this family exhibits tubulin binding ability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-49461
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, KD, WB
AF829
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83936
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
1290-IL
Species: Hu
Applications: BA
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP3-45790
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80779
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Stathmin 1 Antibody (NBP3-16396) (0)

There are no publications for Stathmin 1 Antibody (NBP3-16396).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Stathmin 1 Antibody (NBP3-16396) (0)

There are no reviews for Stathmin 1 Antibody (NBP3-16396). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Stathmin 1 Antibody (NBP3-16396) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stathmin 1 Antibody (7Y7H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol STMN1