STAT6 Antibody (6C10)

Images

 
Western Blot: STAT6 Antibody (6C10) [H00006778-M01] - Analysis of STAT6 monoclonal antibody (M01, clone 6C10) expression in HeLa. Band was detected at a molecular weight of approximately 94 kDa.
Immunocytochemistry/ Immunofluorescence: STAT6 Antibody (6C10) [H00006778-M01] - Analysis of monoclonal antibody to STAT6 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STAT6 Antibody (6C10) [H00006778-M01] - Analysis of monoclonal antibody to STAT6 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: STAT6 Antibody (6C10) [H00006778-M01] - Analysis of STAT6 expression in transfected 293T cell line by STAT6 monoclonal antibody (M01, clone 6C10). Lane 1: STAT6 transfected lysate (Molecular Weight of ...read more
Sandwich ELISA: STAT6 Antibody (6C10) [H00006778-M01] - Detection limit for recombinant GST tagged STAT6 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
6C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STAT6 Antibody (6C10) Summary

Immunogen
STAT6 (NP_003144, 694 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
Specificity
STAT6 (6C10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAT6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Theoretical MW
94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00006778-M01 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STAT6 Antibody (6C10)

  • D12S1644
  • EC 2.4.1.227
  • EC 2.7.7.6
  • IL-4 Stat
  • IL-4-STAT
  • signal transducer and activator of transcription 6
  • signal transducer and activator of transcription 6, interleukin-4 induced
  • STAT, interleukin-4 induced
  • STAT, interleukin4-induced
  • STAT6
  • STAT6B
  • STAT6C
  • transcription factor IL-4 STAT

Background

Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.

References

1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17

2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
M1300CB
Species: Mu
Applications: ELISA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-67868
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB500-470
Species: Hu
Applications: ELISA, Flow
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
M5000
Species: Mu
Applications: ELISA
NB600-922
Species: Ch
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB

Publications for STAT6 Antibody (H00006778-M01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for STAT6 Antibody (H00006778-M01) (0)

There are no reviews for STAT6 Antibody (H00006778-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT6 Antibody (H00006778-M01). (Showing 1 - 1 of 1 FAQ).

  1. For antibodies : STAT5b H00006777-M03; STAT 5a NBR2-00622; STAT3 NBP2-22471; STAT 6 H00006778-M01 - do these detect phosphorylated , unphosphorylated or both forms of STATs?
    • Antibodies H00006777-M03, NBR2-00622,  NBP2-22471,  and H00006778-M01 were raised to recognize total STAT proteins, they do not differentiate between any posttranslational modifications and will recognize both phosphorylated and non-phosphorylated protein. 

Secondary Antibodies

 

Isotype Controls

Additional STAT6 Products

Bioinformatics Tool for STAT6 Antibody (H00006778-M01)

Discover related pathways, diseases and genes to STAT6 Antibody (H00006778-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT6 Antibody (H00006778-M01)

Discover more about diseases related to STAT6 Antibody (H00006778-M01).
 

Pathways for STAT6 Antibody (H00006778-M01)

View related products by pathway.

PTMs for STAT6 Antibody (H00006778-M01)

Learn more about PTMs related to STAT6 Antibody (H00006778-M01).
 

Research Areas for STAT6 Antibody (H00006778-M01)

Find related products by research area.

Blogs on STAT6.

Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT6 Antibody (6C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT6
Entrez
OMIM
Uniprot