Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 678-787 of Human STAT5b Source: Wheat Germ (in vitro) Amino Acid Sequence: VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source | Wheat germ |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | STAT5B |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for STAT5b Partial Recombinant Protein (H00006777-Q01)Find related products by research area.
|
Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | STAT5B |