STAT5b Antibody

Product Discontinued

STAT5b Antibody Summary

• Immunogen: Synthetic peptide directed towards the middle region of mouse STAT5B. Peptide sequence GTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQV.
• Predicted Species: Rat (100%), Canine (93%), Equine (93%), Bovine (93%), Guinea Pig (93%), Rabbit (93%), Zebrafish (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAT5B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against STAT5B and was validated on Western blot.
• Theoretical MW: 86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STAT5b Antibody

• signal transducer and activator of transcription 5B
• STAT5
• STAT5b
• transcription factor STAT5B

Background

STAT5B is encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAT5B
• Uniprot:
  • NP_035619(Mouse)