STAT5A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

STAT5A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAT5A.

  Source: E. coli

  Amino Acid Sequence: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: STAT5A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81051.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STAT5A Recombinant Protein Antigen

• MGF
• signal transducer and activator of transcription 5A
• STAT5
• STAT5a

Background

Stat5 is part of a 7 protein family known as signal transducer and activator of transcription (STAT) which contributes to signal transduction by cytokine, hormone and growth factor (1). Signal transducer and activator of transcription 5 (Stat5) functions both in signal transduction and activation of transcription. It has been found that cytoplasmic Stat5 is translocated to the nucleus in response to phosphorylation. Stat5 225; tyrosine phosphorylation is activated predominantly by IL2 but also by IL-3, IL-5, IL-7, IL-9, IL-15, G-CSF andGM-CSF(2). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity. NCoA-1/SRC-1 acts as a coactivator for both the alpha- and beta-isoforms of Stat5 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: STAT5A