STAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: STAT1 Antibody [NBP1-81579] - Analysis in human urinary bladder and skeletal muscle tissues using NBP1-81579 antibody. Corresponding STAT1 RNA-seq data are presented for the same tissues.

Western Blot: STAT1 Antibody [NBP1-81579] - Analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunocytochemistry/Immunofluorescence: STAT1 Antibody [NBP1-81579] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: STAT1 Antibody [NBP1-81579] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Immunohistochemistry-Paraffin: STAT1 Antibody [NBP1-81579] - Staining of human lymph node shows cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: STAT1 Antibody [NBP1-81579] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urotheilal cells.

Immunohistochemistry-Paraffin: STAT1 Antibody [NBP1-81579] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STAT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STAT1 Protein (NBP1-81579PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for STAT1 Antibody - BSA Free

• CANDF7
• DKFZp686B04100
• ISGF-3
• ISGF-3,91kD
• signal transducer and activator of transcription 1, 91kDa
• signal transducer and activator of transcription-1
• STAT1
• STAT91

Background

STATs (signal transducers and activators of transcription) are a family of cytoplasmic latent transcription factors that are activated to regulate gene expression in response to a large number of extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STATs enter the nucleus to regulate transcription of many different genes. Among the seven STATs (Stat1, Stat2, Stat3, Stat4, Stat5a, Stat5b, and Stat6), Stat1, Stat3, Stat5a, and Stat5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-a, IFN-b, IFN-g and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). STAT1 has two forms, the 91 kDa STAT1a and the 84 kDa STAT1b which are encoded by the same gene with splicing variant.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAT1