Stanniocalcin 1/STC-1 Antibody (4H4) Summary
Immunogen |
STC1 (AAH29044, 141 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
Localization |
Secreted |
Specificity |
STC1 - stanniocalcin 1 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
STC1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Stanniocalcin 1/STC-1 Antibody (4H4)
Background
This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Publications for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M01) (0)
There are no reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Stanniocalcin 1/STC-1 Antibody (H00006781-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Stanniocalcin 1/STC-1 Products
Bioinformatics Tool for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)
Discover related pathways, diseases and genes to Stanniocalcin 1/STC-1 Antibody (H00006781-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)
Discover more about diseases related to Stanniocalcin 1/STC-1 Antibody (H00006781-M01).
| | Pathways for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)
View related products by pathway.
|
PTMs for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)
Learn more about PTMs related to Stanniocalcin 1/STC-1 Antibody (H00006781-M01).
| | Research Areas for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)
Find related products by research area.
|
Blogs on Stanniocalcin 1/STC-1