Stanniocalcin 1/STC-1 Antibody (4H4)

Images

 
Western Blot: Stanniocalcin 1/STC-1 Antibody (4H4) [H00006781-M01] - Detection against Immunogen (37.51 KDa) .

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Stanniocalcin 1/STC-1 Antibody (4H4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
STC1 (AAH29044, 141 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Localization
Secreted
Specificity
STC1 - stanniocalcin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STC1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00006781-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Stanniocalcin 1/STC-1 Antibody (4H4)

  • Stanniocalcin 1
  • stanniocalcin-1
  • STC1
  • STC-1
  • STCSTC-1

Background

This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)(1)

Reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M01) (0)

There are no reviews for Stanniocalcin 1/STC-1 Antibody (H00006781-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Stanniocalcin 1/STC-1 Antibody (H00006781-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Stanniocalcin 1/STC-1 Products

Research Areas for Stanniocalcin 1/STC-1 Antibody (H00006781-M01)

Find related products by research area.

Blogs on Stanniocalcin 1/STC-1

There are no specific blogs for Stanniocalcin 1/STC-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Stanniocalcin 1/STC-1 Antibody (4H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol STC1
Entrez
OMIM
Uniprot